Recombinant Human FLOT2 protein, T7/His-tagged
| Cat.No. : | FLOT2-220H |
| Product Overview : | Recombinant human FLOT2 cDNA (427 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISL EIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQ IYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAEC KKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEA QEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEATVIEAMGKAEAERMKLKAEA YQKYGDAAKMALVLEALPQIAAKIAAPLPVPSGKIKNS |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | FLOT2 flotillin 2 [ Homo sapiens ] |
| Official Symbol | FLOT2 |
| Synonyms | FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; epidermal surface antigen; membrane component chromosome 17 surface marker 1; ECS-1; |
| Gene ID | 2319 |
| mRNA Refseq | NM_004475 |
| Protein Refseq | NP_004466 |
| MIM | 131560 |
| UniProt ID | Q14254 |
| Chromosome Location | 17q11-q12 |
| Pathway | Insulin Signaling, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; |
| ◆ Recombinant Proteins | ||
| FLOT2-357H | Recombinant Human FLOT2 protein, His/MBP-tagged | +Inquiry |
| FLOT2-921H | Recombinant Human FLOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FLOT2-1506H | Recombinant Human FLOT2 Protein, His-tagged | +Inquiry |
| FLOT2-934H | Recombinant Human FLOT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FLOT2-4362H | Recombinant Human FLOT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLOT2-6185HCL | Recombinant Human FLOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLOT2 Products
Required fields are marked with *
My Review for All FLOT2 Products
Required fields are marked with *
