Recombinant Human FLT3L protein FLT3LG-25H

Recombinant Human FLT3L protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FLT3L protein

Recombinant Human FLT3L protein

FLT3LG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FLT3LG-25H
Product Overview : Recombinant Human FLT3L (27–181 of P49771-1 FLT3L_HUMAN) protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities.
Source : Nicotiana benthamiana
Species : Human
Form : Lyophilized from a Tris HCl 0.05M buffer pH 7.4.
Bio-activity : The activity of Flt-3 is determinated by the dose-dependent stimulation of the proliferation of human acute myeloid leukemia cells (OCMI-AML5). ED50 is typically ≤ 1 ng/ml.
Molecular Mass : It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE.
AA Sequence : HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA
Endotoxin : 1 EU/µg determined by LAL method
Purity : >95 % as determined by SDS-PAGE analysis
Applications : BIOASSAY, SDS-PAGE, WB.
Storage : Frozen / Solution. For extended storage, conserve at −80ºC. Repeated freezing and thawing is not recommended. Store working aliquots at 4ºC for up to one week.
Reconstitution : Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines.
Gene Name : FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
Official Symbol : FLT3LG
Synonyms : FLT3LG; fms-related tyrosine kinase 3 ligand; FL; Flt3 ligand
Gene ID : 2323
mRNA Refseq : NM_001459
Protein Refseq : NP_001450
MIM : 600007
UniProt ID : P49771
Chromosome Location : 19q13.3
Pathway : Cytokine-cytokine receptor interaction; atopoietic cell lineage; Pathways in cancer
Function : cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy