Active Recombinant Human FLT3L protein
Cat.No. : | FLT3LG-25H |
Product Overview : | Recombinant Human FLT3L (27–181 of P49771-1 FLT3L_HUMAN) protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Protein Length : | 28-181 a.a. |
Form : | Lyophilized from a Tris HCl 0.05M buffer pH 7.4. |
Bio-activity : | The activity of Flt-3 is determinated by the dose-dependent stimulation of the proliferation of human acute myeloid leukemia cells (OCMI-AML5). ED50 is typically ≤ 1 ng/ml. |
Molecular Mass : | It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE. |
AA Sequence : | HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA |
Endotoxin : | 1 EU/µg determined by LAL method |
Purity : | >95 % as determined by SDS-PAGE analysis |
Applications : | BIOASSAY, SDS-PAGE, WB. |
Storage : | Frozen / Solution. For extended storage, conserve at −80ºC. Repeated freezing and thawing is not recommended. Store working aliquots at 4ºC for up to one week. |
Reconstitution : | Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; FL; Flt3 ligand |
Gene ID | 2323 |
mRNA Refseq | NM_001459 |
Protein Refseq | NP_001450 |
MIM | 600007 |
UniProt ID | P49771 |
Chromosome Location | 19q13.3 |
Pathway | Cytokine-cytokine receptor interaction; atopoietic cell lineage; Pathways in cancer |
Function | cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding |
◆ Recombinant Proteins | ||
FLT3LG-2914H | Recombinant Human FLT3LG Protein (Thr27-Pro184), C-His tagged | +Inquiry |
Flt3l-97M | Recombinant Mouse FLT3LG Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
FLT3LG-155H | Active Recombinant Human FLT3LG protein | +Inquiry |
FLT3LG-514H | Recombinant Human FLT3LG protein | +Inquiry |
FLT3LG-98H | Recombinant Active Human FLT3LG Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *