Recombinant Human FLVCR1 protein, His-tagged
| Cat.No. : | FLVCR1-3836H |
| Product Overview : | Recombinant Human FLVCR1 protein(1-107 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-107 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | FLVCR1 feline leukemia virus subgroup C cellular receptor 1 [ Homo sapiens ] |
| Official Symbol | FLVCR1 |
| Synonyms | FLVCR1; feline leukemia virus subgroup C cellular receptor 1; ataxia, posterior column 1, with retinitis pigmentosa , AXPC1; feline leukemia virus subgroup C receptor-related protein 1; FLVCR; MFSD7B; PCA; AXPC1; PCARP; FLJ33420; |
| mRNA Refseq | NM_014053 |
| Protein Refseq | NP_054772 |
| MIM | 609144 |
| UniProt ID | Q9Y5Y0 |
| Gene ID | 28982 |
| ◆ Recombinant Proteins | ||
| FLVCR1-3139Z | Recombinant Zebrafish FLVCR1 | +Inquiry |
| FLVCR1-4968HF | Recombinant Full Length Human FLVCR1 Protein, GST-tagged | +Inquiry |
| FLVCR1-3836H | Recombinant Human FLVCR1 protein, His-tagged | +Inquiry |
| FLVCR1-6755H | Recombinant Human FLVCR1 protein, GST-tagged | +Inquiry |
| FLVCR1-4380H | Recombinant Human FLVCR1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLVCR1-655HCL | Recombinant Human FLVCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLVCR1 Products
Required fields are marked with *
My Review for All FLVCR1 Products
Required fields are marked with *
