Recombinant Human FMNL1, His-tagged
Cat.No. : | FMNL1-26305TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 848-1100 of Human FMNL1 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 848-1100 a.a. |
Description : | This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVI AEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRG LELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTA QEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAE QEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMD LISELKRRQQKEPLIYESDRDGAIEDIITVIKTVPFTA RTGKRTSRLLCEASLGEEMPL |
Gene Name | FMNL1 formin-like 1 [ Homo sapiens ] |
Official Symbol | FMNL1 |
Synonyms | FMNL1; formin-like 1; C17orf1B, FMNL, formin like; formin-like protein 1; C17orf1; |
Gene ID | 752 |
mRNA Refseq | NM_005892 |
Protein Refseq | NP_005883 |
MIM | 604656 |
Uniprot ID | O95466 |
Chromosome Location | 17q21.31 |
Function | Rho GTPase binding; actin binding; binding; molecular_function; profilin binding; |
◆ Recombinant Proteins | ||
FMNL1-2432H | Recombinant Human FMNL1 Protein, MYC/DDK-tagged | +Inquiry |
FMNL1-26305TH | Recombinant Human FMNL1, His-tagged | +Inquiry |
FMNL1-4982HF | Recombinant Full Length Human FMNL1 Protein, GST-tagged | +Inquiry |
FMNL1-926H | Recombinant Human FMNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FMNL1-412H | Recombinant Human FMNL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FMNL1-658HCL | Recombinant Human FMNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMNL1 Products
Required fields are marked with *
My Review for All FMNL1 Products
Required fields are marked with *