Recombinant Human FN1 Protein, GST tagged

• Cat.No.: FN1-109H
• Product Overview: Recombinant Human Fibronectin III 1H, 8, 10; amino acids I597-T673 joined to A1235-T1325 and V1416-T1509 by a GS linker (*GS*). Human protein expressed in E. coli DH5 alpha carrying the cloned gene.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: Fibronectins (FN) are a family of high molecular weight, multidomain glycoproteins composed of two structurally similar subunits which are joined at the carboxyl terminus by disulfide bonds. The primary structure of FN is organized into three types of repeating homologous units, termed types I, II, and III. These modules in turn are organized into functional domains which have been shown to contain multiple binding sites, including those for sulfated glycosaminoglycans, gelatin, fibrin, and cell surface integrin receptors. Twelve type I modules are found grouped at the amino- and carboxyl-terminal regions, and two type II modules are l centigradeated within the gelatin-binding region. Fifteen to seventeen type III modules are contained within the middle of the molecule and comprise 60% of fibronectin's sequence.
• Form: Solution in PBS
• Molecular Mass: 57177 Da
• AASequence: IQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTST*GS*AVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
• Purity: > 85-90% by SDS-PAGE
• Storage: Store at -80 centigrade.
• Concentration: 3.4 mg/mL

Gene Information

• Synonyms: Fibronectins; FN