Recombinant Human FN1 Protein, GST-tagged
Cat.No. : | FN1-4400H |
Product Overview : | Human FN1 full-length ORF ( AAH05858, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq |
Molecular Mass : | 43.56 kDa |
AA Sequence : | MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
◆ Recombinant Proteins | ||
FN1-34H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-107H | Recombinant Human Fibronectin III 8-10, 13, GST-tagged | +Inquiry |
FN1-35H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-183H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
FN1-38H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *