"FN1" Related Products

Recombinant Human FN1 protein, T7/His-tagged

Cat.No.: FN1-36H
Product Overview: Recombinant thirteenth FN-III domain of Human fibronectin cDNA fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFALEFPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGP MKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTT
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human ES lineage specific differentiation regulations study coating with this protein.2. May be used for in vitro protein-protein interaction mapping.3. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 15 days.
Gene Name: FN1 fibronectin 1 [ Homo sapiens ]
Official Symbol: FN1
Synonyms: FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149;
Gene ID: 2335
mRNA Refseq: NM_002026
Protein Refseq: NP_002017
MIM: 135600
UniProt ID: P02751
Chromosome Location: 2q34
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem;
Function: collagen binding; extracellular matrix structural constituent; heparin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.