Recombinant Human FN1 protein
Cat.No. : | FN1-96H |
Product Overview : | Recombinant full-length third FN-III domain of Human fibronectin cDNA, fused with 206 aa of human Alpha fetal protein (AFP) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSNIEFAVPPPTDLRFTNIGPDTMR VTWAPPPSIDLTNFLVRYSPVKNEE DVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT |
Purity : | > 90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human ES lineage specific differentiation regulations study coating with this protein.2. May be used for in vitro protein-protein interaction mapping.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 15 days. |
Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
Official Symbol | FN1 |
Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
Gene ID | 2335 |
mRNA Refseq | NM_002026 |
Protein Refseq | NP_002017 |
MIM | 135600 |
UniProt ID | P02751 |
Chromosome Location | 2q34 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem |
Function | collagen binding; extracellular matrix structural constituent; heparin binding; protein binding; |
◆ Recombinant Proteins | ||
FN1-01H | Recombinant Human FN1 Protein, T7-His-TEV-tagged | +Inquiry |
FN1-1374H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
FN1-632B | Recombinant Bovine FN1 protein(53-273aa), His&Myc-tagged | +Inquiry |
FN1-882H | Active Recombinant Human FN1 Protein, His-tagged | +Inquiry |
FN1-39H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *