Recombinant Human FN3K, His-tagged
| Cat.No. : | FN3K-26307TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-309 of Human FN3K with N terminal His tag, 39kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-309 a.a. |
| Description : | FN3K catalyzes phosphorylation of fructosamines formed by glycation, the nonenzymatic reaction of glucose with primary amines followed by Amadori rearrangement. Phosphorylation of fructosamines may initiate metabolism of the modified amine and result in deglycation of glycated proteins (Delpierre et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 94 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFV KVNRRTQARQMFEGEVASLEALRSTGLVRVPRPMKVID LPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQK LREKLKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQ VNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWS RLQVKIPDLFCGLEIVPALLHGDLWSGNVAEDDVGPII YDPASFYGHSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPSLGTMRRLLK |
| Full Length : | Full L. |
| Gene Name | FN3K fructosamine 3 kinase [ Homo sapiens ] |
| Official Symbol | FN3K |
| Synonyms | FN3K; fructosamine 3 kinase; fructosamine-3-kinase; |
| Gene ID | 64122 |
| mRNA Refseq | NM_022158 |
| Protein Refseq | NP_071441 |
| MIM | 608425 |
| Uniprot ID | Q9H479 |
| Chromosome Location | 17q25 |
| Function | fructosamine-3-kinase activity; |
| ◆ Recombinant Proteins | ||
| FN3K-12951H | Recombinant Human FN3K, GST-tagged | +Inquiry |
| FN3K-4401H | Recombinant Human FN3K Protein, GST-tagged | +Inquiry |
| Fn3k-3059M | Recombinant Mouse Fn3k Protein, Myc/DDK-tagged | +Inquiry |
| FN3K-3612H | Recombinant Human FN3K Protein (Met1-Lys309), His tagged | +Inquiry |
| FN3K-7102H | Recombinant Human FN3K, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FN3K-6177HCL | Recombinant Human FN3K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN3K Products
Required fields are marked with *
My Review for All FN3K Products
Required fields are marked with *
