Recombinant Human FNDC3A protein, His-tagged
Cat.No. : | FNDC3A-2906H |
Product Overview : | Recombinant Human FNDC3A protein(111-250 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LHRSPHPPLPGFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQIAGGINTGSAKIKSGKGKGGTQVDT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FNDC3A fibronectin type III domain containing 3A [ Homo sapiens ] |
Official Symbol | FNDC3A |
Synonyms | FNDC3A; fibronectin type III domain containing 3A; fibronectin type III domain containing 3 , FNDC3; fibronectin type-III domain-containing protein 3A; bA203I16.5; KIAA0970; human gene expressed in odontoblasts; HUGO; FNDC3; bA203I16.1; FLJ31509; RP11-203I16.5; |
Gene ID | 22862 |
mRNA Refseq | NM_001079673 |
Protein Refseq | NP_001073141 |
UniProt ID | Q9Y2H6 |
◆ Recombinant Proteins | ||
FNDC3A-12955H | Recombinant Human FNDC3A, GST-tagged | +Inquiry |
FNDC3A-4407H | Recombinant Human FNDC3A Protein, GST-tagged | +Inquiry |
FNDC3A-2052C | Recombinant Chicken FNDC3A | +Inquiry |
FNDC3A-3300M | Recombinant Mouse FNDC3A Protein, His (Fc)-Avi-tagged | +Inquiry |
FNDC3A-2906H | Recombinant Human FNDC3A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC3A-6174HCL | Recombinant Human FNDC3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC3A Products
Required fields are marked with *
My Review for All FNDC3A Products
Required fields are marked with *
0
Inquiry Basket