Recombinant Human FNDC3B protein(278-570aa), His-tagged

• Cat.No.: FNDC3B-6432H
• Product Overview: Recombinant Human FNDC3B protein(Q53EP0)(278-570aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 278-570aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD

Gene Information

• Gene Name: FNDC3B fibronectin type III domain containing 3B [ Homo sapiens ]
• Official Symbol: FNDC3B
• Synonyms: FNDC3B; fibronectin type III domain containing 3B; fibronectin type III domain-containing protein 3B; DKFZp762K137; FAD104; FLJ23399; PRO4979; YVTM2421; HCV NS5A-binding protein 37; factor for adipocyte differentiation 104; MGC10002; DKFZp686D14170
• Gene ID: 64778
• mRNA Refseq: NM_001135095
• Protein Refseq: NP_001128567
• MIM: 611909
• UniProt ID: Q53EP0