Recombinant Human FNDC3B protein(278-570aa), His-tagged

Cat.No. : FNDC3B-6432H
Product Overview : Recombinant Human FNDC3B protein(Q53EP0)(278-570aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 278-570aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD
Gene Name FNDC3B fibronectin type III domain containing 3B [ Homo sapiens ]
Official Symbol FNDC3B
Synonyms FNDC3B; fibronectin type III domain containing 3B; fibronectin type III domain-containing protein 3B; DKFZp762K137; FAD104; FLJ23399; PRO4979; YVTM2421; HCV NS5A-binding protein 37; factor for adipocyte differentiation 104; MGC10002; DKFZp686D14170;
Gene ID 64778
mRNA Refseq NM_001135095
Protein Refseq NP_001128567
MIM 611909
UniProt ID Q53EP0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC3B Products

Required fields are marked with *

My Review for All FNDC3B Products

Required fields are marked with *

0
cart-icon