Recombinant Human FNDC3B protein(278-570aa), His-tagged
Cat.No. : | FNDC3B-6432H |
Product Overview : | Recombinant Human FNDC3B protein(Q53EP0)(278-570aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 278-570aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD |
Gene Name | FNDC3B fibronectin type III domain containing 3B [ Homo sapiens ] |
Official Symbol | FNDC3B |
Synonyms | FNDC3B; fibronectin type III domain containing 3B; fibronectin type III domain-containing protein 3B; DKFZp762K137; FAD104; FLJ23399; PRO4979; YVTM2421; HCV NS5A-binding protein 37; factor for adipocyte differentiation 104; MGC10002; DKFZp686D14170; |
Gene ID | 64778 |
mRNA Refseq | NM_001135095 |
Protein Refseq | NP_001128567 |
MIM | 611909 |
UniProt ID | Q53EP0 |
◆ Recombinant Proteins | ||
FNDC3B-6432H | Recombinant Human FNDC3B protein(278-570aa), His-tagged | +Inquiry |
FNDC3B-4571C | Recombinant Chicken FNDC3B | +Inquiry |
FNDC3B-12956H | Recombinant Human FNDC3B, His-tagged | +Inquiry |
FNDC3B-3301M | Recombinant Mouse FNDC3B Protein, His (Fc)-Avi-tagged | +Inquiry |
FNDC3B-5956M | Recombinant Mouse FNDC3B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC3B Products
Required fields are marked with *
My Review for All FNDC3B Products
Required fields are marked with *
0
Inquiry Basket