Recombinant Human FNDC4 protein, T7/His-tagged
Cat.No. : | FNDC4-121H |
Product Overview : | Recombinant human FNDC4 cDNA (45 - 167aa, derived from BC032725) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 45-167 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQ RVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human FNDC4 functional study using recombinant FNDC4 protein mediated intracellular delivery.2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ] |
Official Symbol | FNDC4 |
Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1 |
Gene ID | 64838 |
mRNA Refseq | NM_022823 |
Protein Refseq | NP_073734 |
MIM | 611905 |
UniProt ID | Q9H6D8 |
Chromosome Location | 2p23.3 |
◆ Recombinant Proteins | ||
FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
FNDC4-5007HF | Recombinant Full Length Human FNDC4 Protein, GST-tagged | +Inquiry |
FNDC4-4330H | Recombinant Human FNDC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FNDC4-929H | Recombinant Human FNDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FNDC4-121H | Recombinant Human FNDC4 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *
0
Inquiry Basket