Recombinant Human FNDC5 Protein, GST-tagged

Cat.No. : FNDC5-4410H
Product Overview : Human FNDC5 full-length ORF ( NP_715637.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-137 aa
Description : This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Molecular Mass : 41.9 kDa
AA Sequence : MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
Official Symbol FNDC5
Synonyms FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2;
Gene ID 252995
mRNA Refseq NM_001171940
Protein Refseq NP_001165411
MIM 611906
UniProt ID Q8NAU1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FNDC5 Products

Required fields are marked with *

My Review for All FNDC5 Products

Required fields are marked with *

0
cart-icon