Recombinant Human FOLR2
Cat.No. : | FOLR2-28943TH |
Product Overview : | Recombinant fragment of Human FOLR2 with N terminal proprietary tag; Predicted MWt 35.86 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 93 amino acids |
Description : | The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. |
Molecular Weight : | 35.860kDa |
Tissue specificity : | Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL |
Sequence Similarities : | Belongs to the folate receptor family. |
Gene Name | FOLR2 folate receptor 2 (fetal) [ Homo sapiens ] |
Official Symbol | FOLR2 |
Synonyms | FOLR2; folate receptor 2 (fetal); folate receptor beta; |
Gene ID | 2350 |
mRNA Refseq | NM_000803 |
Protein Refseq | NP_000794 |
MIM | 136425 |
Uniprot ID | P14207 |
Chromosome Location | 11q13.3-q14.1 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function | folic acid binding; receptor activity; |
◆ Recombinant Proteins | ||
FOLR2-1434H | Active Recombinant Human FOLR2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
FOLR2-005H | Active Recombinant Human FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-1435C | Active Recombinant Cynomolgus FOLR2 protein, His-tagged | +Inquiry |
FOLR2-2244H | Recombinant Human FOLR2 protein(Met1-His228), His-tagged | +Inquiry |
FOLR2-28943TH | Recombinant Human FOLR2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR2-2541HCL | Recombinant Human FOLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLR2 Products
Required fields are marked with *
My Review for All FOLR2 Products
Required fields are marked with *
0
Inquiry Basket