Recombinant Human FOLR2

Cat.No. : FOLR2-28943TH
Product Overview : Recombinant fragment of Human FOLR2 with N terminal proprietary tag; Predicted MWt 35.86 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 93 amino acids
Description : The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
Molecular Weight : 35.860kDa
Tissue specificity : Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL
Sequence Similarities : Belongs to the folate receptor family.
Gene Name FOLR2 folate receptor 2 (fetal) [ Homo sapiens ]
Official Symbol FOLR2
Synonyms FOLR2; folate receptor 2 (fetal); folate receptor beta;
Gene ID 2350
mRNA Refseq NM_000803
Protein Refseq NP_000794
MIM 136425
Uniprot ID P14207
Chromosome Location 11q13.3-q14.1
Pathway Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function folic acid binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOLR2 Products

Required fields are marked with *

My Review for All FOLR2 Products

Required fields are marked with *

0
cart-icon