Recombinant Human FOSL2 Protein, GST-tagged
Cat.No. : | FOSL2-4428H |
Product Overview : | Human FOSL2 full-length ORF ( AAH08899, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq |
Molecular Mass : | 39.16 kDa |
AA Sequence : | MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOSL2 FOS-like antigen 2 [ Homo sapiens ] |
Official Symbol | FOSL2 |
Synonyms | FOSL2; FOS-like antigen 2; fos-related antigen 2; FLJ23306; FRA2; FRA-2; |
Gene ID | 2355 |
mRNA Refseq | NM_005253 |
Protein Refseq | NP_005244 |
MIM | 601575 |
UniProt ID | P15408 |
◆ Recombinant Proteins | ||
FOSL2-1739R | Recombinant Rhesus monkey FOSL2 Protein, His-tagged | +Inquiry |
FOSL2-799H | Recombinant Human FOSL2 Protein, His-tagged | +Inquiry |
FOSL2-1561R | Recombinant Rhesus Macaque FOSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOSL2-4428H | Recombinant Human FOSL2 Protein, GST-tagged | +Inquiry |
FOSL2-5974M | Recombinant Mouse FOSL2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL2-6165HCL | Recombinant Human FOSL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL2 Products
Required fields are marked with *
My Review for All FOSL2 Products
Required fields are marked with *