Recombinant Human FOSL2 Protein, GST-tagged

• Cat.No.: FOSL2-4428H
• Product Overview: Human FOSL2 full-length ORF ( AAH08899, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq
• Molecular Mass: 39.16 kDa
• AA Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOSL2 FOS-like antigen 2 [ Homo sapiens ]
• Official Symbol: FOSL2
• Synonyms: FOSL2; FOS-like antigen 2; fos-related antigen 2; FLJ23306; FRA2; FRA-2
• Gene ID: 2355
• mRNA Refseq: NM_005253
• Protein Refseq: NP_005244
• MIM: 601575
• UniProt ID: P15408