"FOXA3" Related Products

Expand
Expand
Expand

Recombinant Human FOXA3 protein, Arginine-tagged

Cat.No.: FOXA3-133H
Product Overview: Recombinant human FOXA3 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: GEFLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAP LGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIM DLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGG SGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPY NFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNASLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for study of Human liver cell differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: FOXA3 forkhead box A3 [ Homo sapiens ]
Official Symbol: FOXA3
Synonyms: FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; FKHH3; HNF3G; TCF3G; MGC10179;
Gene ID: 3171
mRNA Refseq: NM_004497
Protein Refseq: NP_004488
MIM: 602295
UniProt ID: P55318
Chromosome Location: 19q13.2-q13.4
Pathway: Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem;
Function: DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.