Recombinant Human FOXA3 protein, Arginine-tagged
| Cat.No. : | FOXA3-133H |
| Product Overview : | Recombinant human FOXA3 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | GEFLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAP LGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIM DLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGG SGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPY NFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNASLEESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein transduction for study of Human liver cell differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | FOXA3 forkhead box A3 [ Homo sapiens ] |
| Official Symbol | FOXA3 |
| Synonyms | FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; FKHH3; HNF3G; TCF3G; MGC10179; |
| Gene ID | 3171 |
| mRNA Refseq | NM_004497 |
| Protein Refseq | NP_004488 |
| MIM | 602295 |
| UniProt ID | P55318 |
| Chromosome Location | 19q13.2-q13.4 |
| Pathway | Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; |
| Function | DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; |
| ◆ Recombinant Proteins | ||
| FOXA3-5047HF | Recombinant Full Length Human FOXA3 Protein, GST-tagged | +Inquiry |
| FOXA3-1511H | Recombinant Human FOXA3 Protein, His-tagged | +Inquiry |
| FOXA3-8889Z | Recombinant Zebrafish FOXA3 | +Inquiry |
| Foxa3-1512M | Recombinant Mouse Foxa3 Protein, His-tagged | +Inquiry |
| FOXA3-2384R | Recombinant Rat FOXA3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXA3-662HCL | Recombinant Human FOXA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXA3 Products
Required fields are marked with *
My Review for All FOXA3 Products
Required fields are marked with *



