"FOXA3" Related Products

Expand

Recombinant Human FOXA3 Protein, GST-tagged

Cat.No. : FOXA3-4435H
Product Overview : Human FOXA3 full-length ORF ( NP_004488.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 63.5 kDa
AA Sequence : MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : FOXA3 forkhead box A3 [ Homo sapiens ]
Official Symbol : FOXA3
Synonyms : FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma, HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; fork head-related protein FKH H3; hepatocyte nuclear factor 3, gamma; FKHH3; HNF3G; TCF3G; MGC10179;
Gene ID : 3171
mRNA Refseq : NM_004497
Protein Refseq : NP_004488
MIM : 602295
UniProt ID : P55318

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.