Recombinant Human FOXD2

• Cat.No.: FOXD2-28109TH
• Product Overview: Recombinant fragment of Human FOXD2 (amino acids 411-494) with a N terminal proprietary tag; Predicted MWt 34.87 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 84 amino acids
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined.
• Molecular Weight: 34.870kDa inclusive of tags
• Tissue specificity: Kidney specific.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
• Sequence Similarities: Contains 1 fork-head DNA-binding domain.

Gene Information

• Gene Name: FOXD2 forkhead box D2 [ Homo sapiens ]
• Official Symbol: FOXD2
• Synonyms: FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9
• Gene ID: 2306
• mRNA Refseq: NM_004474
• Protein Refseq: NP_004465
• MIM: 602211
• Uniprot ID: O60548
• Chromosome Location: 1p34-p32
• Function: DNA bending activity; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity