"FOXD2" Related Products

Recombinant Human FOXD2 Protein, GST-tagged

Cat.No.: FOXD2-4441H
Product Overview: Human FOXD2 partial ORF ( NP_004465.2, 411 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 34.98 kDa
AA Sequence: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FOXD2 forkhead box D2 [ Homo sapiens ]
Official Symbol: FOXD2
Synonyms: FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9; forkhead-like 17; forkhead-related activator 9; forkhead-related protein FKHL17; forkhead, drosophila, homolog-like 17; forkhead-related transcription factor 9; FREAC-9;
Gene ID: 2306
mRNA Refseq: NM_004474
Protein Refseq: NP_004465
MIM: 602211
UniProt ID: O60548

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.