Recombinant Human FOXD2 Protein, GST-tagged
Cat.No. : | FOXD2-4441H |
Product Overview : | Human FOXD2 partial ORF ( NP_004465.2, 411 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq |
Molecular Mass : | 34.98 kDa |
AA Sequence : | SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXD2 forkhead box D2 [ Homo sapiens ] |
Official Symbol | FOXD2 |
Synonyms | FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9; forkhead-like 17; forkhead-related activator 9; forkhead-related protein FKHL17; forkhead, drosophila, homolog-like 17; forkhead-related transcription factor 9; FREAC-9; |
Gene ID | 2306 |
mRNA Refseq | NM_004474 |
Protein Refseq | NP_004465 |
MIM | 602211 |
UniProt ID | O60548 |
◆ Recombinant Proteins | ||
FOXD2-3319M | Recombinant Mouse FOXD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXD2-2963H | Recombinant Human FOXD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Foxd2-1514M | Recombinant Mouse Foxd2 Protein, His&GST-tagged | +Inquiry |
FOXD2-28109TH | Recombinant Human FOXD2 | +Inquiry |
FOXD2-6511C | Recombinant Chicken FOXD2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXD2 Products
Required fields are marked with *
My Review for All FOXD2 Products
Required fields are marked with *