Cat.No.:	FOXD2-4441H
Product Overview:	Human FOXD2 partial ORF ( NP_004465.2, 411 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	34.98 kDa
AA Sequence:	SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name:	FOXD2 forkhead box D2 [ Homo sapiens ]
Official Symbol:	FOXD2
Synonyms:	FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9; forkhead-like 17; forkhead-related activator 9; forkhead-related protein FKHL17; forkhead, drosophila, homolog-like 17; forkhead-related transcription factor 9; FREAC-9;
Gene ID:	2306
mRNA Refseq:	NM_004474
Protein Refseq:	NP_004465
MIM:	602211
UniProt ID:	O60548

Online Inquiry