Recombinant Human FOXD3 protein, GST-tagged
Cat.No. : | FOXD3-301510H |
Product Overview : | Recombinant Human FOXD3 (1-138 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser138 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FOXD3 forkhead box D3 [ Homo sapiens ] |
Official Symbol | FOXD3 |
Synonyms | FOXD3; forkhead box D3; forkhead box protein D3; Genesis; HFH2; HNF3/FH transcription factor genesis; AIS1; VAMAS2; |
Gene ID | 27022 |
mRNA Refseq | NM_012183 |
Protein Refseq | NP_036315 |
MIM | 611539 |
UniProt ID | Q9UJU5 |
◆ Recombinant Proteins | ||
Foxd3-1515R | Recombinant Rat Foxd3 Protein, His-tagged | +Inquiry |
FOXD3-1741R | Recombinant Rhesus monkey FOXD3 Protein, His-tagged | +Inquiry |
FOXD3-144H | Recombinant Human FOXD3 protein, Arginine-tagged | +Inquiry |
FOXD3-1563R | Recombinant Rhesus Macaque FOXD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXD3-1062H | Recombinant Human FOXD3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXD3 Products
Required fields are marked with *
My Review for All FOXD3 Products
Required fields are marked with *