Recombinant Human FOXG1
| Cat.No. : | FOXG1-28945TH |
| Product Overview : | Recombinant fragment of Human FOXG1 with N terminal proprietary tag, 32.24kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 61 amino acids |
| Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. |
| Molecular Weight : | 32.240kDa inclusive of tags |
| Tissue specificity : | Expression is restricted to the neurons of the developing telencephalon. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE |
| Sequence Similarities : | Contains 1 fork-head DNA-binding domain. |
| Gene Name | FOXG1 forkhead box G1 [ Homo sapiens ] |
| Official Symbol | FOXG1 |
| Synonyms | FOXG1; forkhead box G1; FKH2, FKHL1, FKHL2, FKHL3, FKHL4, forkhead box G1A , forkhead box G1B , forkhead box G1C , FOXG1A, FOXG1B, FOXG1C; forkhead box protein G1; BF1; HBF 3; HFK1; HFK2; HFK3; QIN; |
| Gene ID | 2290 |
| mRNA Refseq | NM_005249 |
| Protein Refseq | NP_005240 |
| MIM | 164874 |
| Uniprot ID | P55316 |
| Chromosome Location | 14q11-q13 |
| Pathway | Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; |
| Function | DNA bending activity; DNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding; |
| ◆ Recombinant Proteins | ||
| FOXG1-4452H | Recombinant Human FOXG1 Protein, GST-tagged | +Inquiry |
| FOXG1-2385R | Recombinant Rat FOXG1 Protein | +Inquiry |
| FOXG1-12974H | Recombinant Human FOXG1, His-tagged | +Inquiry |
| FOXG1-28945TH | Recombinant Human FOXG1 | +Inquiry |
| FOXG1-4451H | Recombinant Human FOXG1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXG1 Products
Required fields are marked with *
My Review for All FOXG1 Products
Required fields are marked with *
