Recombinant Human FOXG1

• Cat.No.: FOXG1-28945TH
• Product Overview: Recombinant fragment of Human FOXG1 with N terminal proprietary tag, 32.24kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 61 amino acids
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
• Molecular Weight: 32.240kDa inclusive of tags
• Tissue specificity: Expression is restricted to the neurons of the developing telencephalon.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
• Sequence Similarities: Contains 1 fork-head DNA-binding domain.

Gene Information

• Gene Name: FOXG1 forkhead box G1 [ Homo sapiens ]
• Official Symbol: FOXG1
• Synonyms: FOXG1; forkhead box G1; FKH2, FKHL1, FKHL2, FKHL3, FKHL4, forkhead box G1A , forkhead box G1B , forkhead box G1C , FOXG1A, FOXG1B, FOXG1C; forkhead box protein G1; BF1; HBF 3; HFK1; HFK2; HFK3; QIN
• Gene ID: 2290
• mRNA Refseq: NM_005249
• Protein Refseq: NP_005240
• MIM: 164874
• Uniprot ID: P55316
• Chromosome Location: 14q11-q13
• Pathway: Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem
• Function: DNA bending activity; DNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding