Recombinant Human FOXG1

Cat.No. : FOXG1-28945TH
Product Overview : Recombinant fragment of Human FOXG1 with N terminal proprietary tag, 32.24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 61 amino acids
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
Molecular Weight : 32.240kDa inclusive of tags
Tissue specificity : Expression is restricted to the neurons of the developing telencephalon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
Sequence Similarities : Contains 1 fork-head DNA-binding domain.
Gene Name FOXG1 forkhead box G1 [ Homo sapiens ]
Official Symbol FOXG1
Synonyms FOXG1; forkhead box G1; FKH2, FKHL1, FKHL2, FKHL3, FKHL4, forkhead box G1A , forkhead box G1B , forkhead box G1C , FOXG1A, FOXG1B, FOXG1C; forkhead box protein G1; BF1; HBF 3; HFK1; HFK2; HFK3; QIN;
Gene ID 2290
mRNA Refseq NM_005249
Protein Refseq NP_005240
MIM 164874
Uniprot ID P55316
Chromosome Location 14q11-q13
Pathway Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function DNA bending activity; DNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXG1 Products

Required fields are marked with *

My Review for All FOXG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon