Recombinant Human FOXG1 Protein, GST-tagged
Cat.No. : | FOXG1-4452H |
Product Overview : | Recombinant Human FOXG2 (183-291) Protein with GST tag was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 183-291 |
Description : | This locus encodes a member of the fork-head transcription factor family. The encoded protein, which functions as a transcriptional repressor, is highly expressed in neural tissues during brain development. Mutations at this locus have been associated with Rett syndrome and a diverse spectrum of neurodevelopmental disorders defined as part of the FOXG1 syndrome. This gene is disregulated in many types of cancer and is the target of multiple microRNAs that regulate the proliferation of tumor cells. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR |
Purity : | >10% by SDS-PAGE and Coomassie blue staining |
Applications : | WB, ELISA, PA, PAGE, AP |
Storage : | Store at -80 centigrade. Avoid freeze-thaw cycles. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative : | No Preservative |
Gene Name | FOXG1 forkhead box G1 [ Homo sapiens (human) ] |
Official Symbol | FOXG1 |
Synonyms | FOXG1; forkhead box G1; BF1; BF2; QIN; FKH2; HBF2; HFK1; HFK2; HFK3; KHL2; FHKL3; FKHL1; FKHL2; FKHL3; FKHL4; HBF-1; HBF-2; HBF-3; FOXG1A; FOXG1B; FOXG1C; HBF-G2; forkhead box protein G1; brain factor 1; brain factor 2; forkhead-like 1; forkhead-like 2; forkhead-like 3; forkhead-like 4; oncogene QIN |
Gene ID | 2290 |
mRNA Refseq | NM_005249 |
Protein Refseq | NP_005240 |
MIM | 164874 |
UniProt ID | P55316 |
◆ Recombinant Proteins | ||
FOXG1-4452H | Recombinant Human FOXG1 Protein, GST-tagged | +Inquiry |
FOXG1-7654H | Recombinant Human FOXG1 protein, His-tagged | +Inquiry |
FOXG1-28945TH | Recombinant Human FOXG1 | +Inquiry |
FOXG1-12974H | Recombinant Human FOXG1, His-tagged | +Inquiry |
FOXG1-4451H | Recombinant Human FOXG1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXG1 Products
Required fields are marked with *
My Review for All FOXG1 Products
Required fields are marked with *
0
Inquiry Basket