Recombinant Human FOXG1 Protein, GST-tagged

Cat.No. : FOXG1-4452H
Product Overview : Recombinant Human FOXG2 (183-291) Protein with GST tag was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 183-291
Description : This locus encodes a member of the fork-head transcription factor family. The encoded protein, which functions as a transcriptional repressor, is highly expressed in neural tissues during brain development. Mutations at this locus have been associated with Rett syndrome and a diverse spectrum of neurodevelopmental disorders defined as part of the FOXG1 syndrome. This gene is disregulated in many types of cancer and is the target of multiple microRNAs that regulate the proliferation of tumor cells.
Molecular Mass : 37.73 kDa
AA Sequence : PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR
Purity : >10% by SDS-PAGE and Coomassie blue staining
Applications : WB, ELISA, PA, PAGE, AP
Storage : Store at -80 centigrade. Avoid freeze-thaw cycles.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative : No Preservative
Gene Name FOXG1 forkhead box G1 [ Homo sapiens (human) ]
Official Symbol FOXG1
Synonyms FOXG1; forkhead box G1; BF1; BF2; QIN; FKH2; HBF2; HFK1; HFK2; HFK3; KHL2; FHKL3; FKHL1; FKHL2; FKHL3; FKHL4; HBF-1; HBF-2; HBF-3; FOXG1A; FOXG1B; FOXG1C; HBF-G2; forkhead box protein G1; brain factor 1; brain factor 2; forkhead-like 1; forkhead-like 2; forkhead-like 3; forkhead-like 4; oncogene QIN
Gene ID 2290
mRNA Refseq NM_005249
Protein Refseq NP_005240
MIM 164874
UniProt ID P55316

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXG1 Products

Required fields are marked with *

My Review for All FOXG1 Products

Required fields are marked with *

0
cart-icon