Recombinant Human FOXL1 Protein, GST-tagged

Cat.No. : FOXL1-4462H
Product Overview : Human FOXL1 partial ORF ( NP_005241.1, 221 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. [provided by RefSeq, Nov 2012]
Molecular Mass : 36.63 kDa
AA Sequence : AAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXL1 forkhead box L1 [ Homo sapiens ]
Official Symbol FOXL1
Synonyms FOXL1; forkhead box L1; FKHL11; forkhead box protein L1; FKH6; FREAC7; FREAC-7; forkhead-like 11; forkhead-related protein FKHL11; forkhead-related transcription factor 7;
Gene ID 2300
mRNA Refseq NM_005250
Protein Refseq NP_005241
MIM 603252
UniProt ID Q12952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXL1 Products

Required fields are marked with *

My Review for All FOXL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon