Recombinant Human FOXL1 Protein, GST-tagged

• Cat.No.: FOXL1-4462H
• Product Overview: Human FOXL1 partial ORF ( NP_005241.1, 221 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. [provided by RefSeq, Nov 2012]
• Molecular Mass: 36.63 kDa
• AA Sequence: AAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXL1 forkhead box L1 [ Homo sapiens ]
• Official Symbol: FOXL1
• Synonyms: FOXL1; forkhead box L1; FKHL11; forkhead box protein L1; FKH6; FREAC7; FREAC-7; forkhead-like 11; forkhead-related protein FKHL11; forkhead-related transcription factor 7
• Gene ID: 2300
• mRNA Refseq: NM_005250
• Protein Refseq: NP_005241
• MIM: 603252
• UniProt ID: Q12952