Recombinant Human FOXL1 Protein, GST-tagged
Cat.No. : | FOXL1-4462H |
Product Overview : | Human FOXL1 partial ORF ( NP_005241.1, 221 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. [provided by RefSeq, Nov 2012] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXL1 forkhead box L1 [ Homo sapiens ] |
Official Symbol | FOXL1 |
Synonyms | FOXL1; forkhead box L1; FKHL11; forkhead box protein L1; FKH6; FREAC7; FREAC-7; forkhead-like 11; forkhead-related protein FKHL11; forkhead-related transcription factor 7; |
Gene ID | 2300 |
mRNA Refseq | NM_005250 |
Protein Refseq | NP_005241 |
MIM | 603252 |
UniProt ID | Q12952 |
◆ Recombinant Proteins | ||
Foxl1-3074M | Recombinant Mouse Foxl1 Protein, Myc/DDK-tagged | +Inquiry |
FOXL1-2563H | Recombinant Human FOXL1 Protein, MYC/DDK-tagged | +Inquiry |
FOXL1-11218Z | Recombinant Zebrafish FOXL1 | +Inquiry |
FOXL1-3330M | Recombinant Mouse FOXL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXL1-4462H | Recombinant Human FOXL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXL1-664HCL | Recombinant Human FOXL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXL1 Products
Required fields are marked with *
My Review for All FOXL1 Products
Required fields are marked with *