Recombinant Human FPR3 Protein, GST-tagged

Cat.No. : FPR3-4489H
Product Overview : Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 254-353 a.a.
Description : FPR3 (Formyl Peptide Receptor 3) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Integrin Pathway. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR2.
Molecular Mass : 36.63 kDa
AA Sequence : WFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FPR3 formyl peptide receptor 3 [ Homo sapiens ]
Official Symbol FPR3
Synonyms FPR3; formyl peptide receptor 3; formyl peptide receptor like 2, FPRL2; N-formyl peptide receptor 3; FMLPY; FPRH1; RMLP R I; FMLP-R-II; FMLP-related receptor II; formyl peptide receptor-like 2; FPRH2; FPRL2; RMLP-R-I; FML2_HUMAN;
Gene ID 2359
mRNA Refseq NM_002030
Protein Refseq NP_002021
MIM 136539
UniProt ID P25089

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FPR3 Products

Required fields are marked with *

My Review for All FPR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon