Recombinant Human FPR3 Protein, GST-tagged
Cat.No. : | FPR3-4489H |
Product Overview : | Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 254-353 a.a. |
Description : | FPR3 (Formyl Peptide Receptor 3) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Integrin Pathway. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR2. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | WFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FPR3 formyl peptide receptor 3 [ Homo sapiens ] |
Official Symbol | FPR3 |
Synonyms | FPR3; formyl peptide receptor 3; formyl peptide receptor like 2, FPRL2; N-formyl peptide receptor 3; FMLPY; FPRH1; RMLP R I; FMLP-R-II; FMLP-related receptor II; formyl peptide receptor-like 2; FPRH2; FPRL2; RMLP-R-I; FML2_HUMAN; |
Gene ID | 2359 |
mRNA Refseq | NM_002030 |
Protein Refseq | NP_002021 |
MIM | 136539 |
UniProt ID | P25089 |
◆ Recombinant Proteins | ||
FPR3-5135HF | Recombinant Full Length Human FPR3 Protein | +Inquiry |
FPR3-4489H | Recombinant Human FPR3 Protein, GST-tagged | +Inquiry |
RFL25328PF | Recombinant Full Length Pan Troglodytes N-Formyl Peptide Receptor 3(Fpr3) Protein, His-Tagged | +Inquiry |
FPR3-4488H | Recombinant Human FPR3 Protein | +Inquiry |
RFL13984PF | Recombinant Full Length Pongo Pygmaeus N-Formyl Peptide Receptor 3(Fpr3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR3 Products
Required fields are marked with *
My Review for All FPR3 Products
Required fields are marked with *