Recombinant Human FRZB protein, GST-tagged
| Cat.No. : | FRZB-1874H |
| Product Overview : | Recombinant Human FRZB protein(153-325 aa), fused to GST tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 153-325 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FRZB frizzled-related protein [ Homo sapiens ] |
| Official Symbol | FRZB |
| Synonyms | FRZB; frizzled-related protein; secreted frizzled-related protein 3; FRE; FRITZ; FRP 3; FRZB 1; FRZB PEN; FRZB1; FZRB; hFIZ; SFRP3; SRFP3; sFRP-3; frezzled; frizzled homolog-related; frizzled-related protein 1; OS1; FRP-3; FRZB-1; FRZB-PEN; |
| Gene ID | 2487 |
| mRNA Refseq | NM_001463 |
| Protein Refseq | NP_001454 |
| MIM | 605083 |
| UniProt ID | Q92765 |
| ◆ Recombinant Proteins | ||
| MYOZ3-4460H | Recombinant Human MYOZ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FRZB-5071HF | Recombinant Full Length Human FRZB Protein, GST-tagged | +Inquiry |
| FRZB-3270H | Recombinant Human FRZB protein(Ala32-Asn325), His-tagged | +Inquiry |
| FRZB-216H | Recombinant Human FRZB, His tagged | +Inquiry |
| FRZB-1754R | Recombinant Rhesus monkey FRZB Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FRZB-873HCL | Recombinant Human FRZB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOZ3 Products
Required fields are marked with *
My Review for All MYOZ3 Products
Required fields are marked with *
