Recombinant Human FRZB protein, GST-tagged

Cat.No. : FRZB-1874H
Product Overview : Recombinant Human FRZB protein(153-325 aa), fused to GST tag, was expressed in E. coli.
Availability May 22, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 153-325 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : IVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FRZB frizzled-related protein [ Homo sapiens ]
Official Symbol FRZB
Synonyms FRZB; frizzled-related protein; secreted frizzled-related protein 3; FRE; FRITZ; FRP 3; FRZB 1; FRZB PEN; FRZB1; FZRB; hFIZ; SFRP3; SRFP3; sFRP-3; frezzled; frizzled homolog-related; frizzled-related protein 1; OS1; FRP-3; FRZB-1; FRZB-PEN;
Gene ID 2487
mRNA Refseq NM_001463
Protein Refseq NP_001454
MIM 605083
UniProt ID Q92765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOZ3 Products

Required fields are marked with *

My Review for All MYOZ3 Products

Required fields are marked with *

0
cart-icon
0
compare icon