Recombinant Human FSD1L protein, His-tagged

• Cat.No.: FSD1L-658H
• Product Overview: Recombinant Human FSD1L protein(NP_001138785.1)(418-530 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 418-530 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FSD1L fibronectin type III and SPRY domain containing 1-like [ Homo sapiens ]
• Official Symbol: FSD1L
• Synonyms: fibronectin type III and SPRY domain containing 1-like; 13753; Ensembl:ENSG00000106701; MGC45564; FSD1-like protein;FSD1 C-terminal like;FSD1 N-terminal like;FSD1 N-terminal-like protein;coiled-coil domain containing 10;cystatin and DUF19 domain containing 1;coiled-coil domain-containing protein 10; MIR1; CCDC10; FSD1CL; FSD1NL; CSDUFD1
• Gene ID: 83856
• mRNA Refseq: NM_001145313.1
• Protein Refseq: NP_001138785.1
• MIM: 609829
• UniProt ID: B7Z3W5