Recombinant Human FSD1L protein, His-tagged
| Cat.No. : | FSD1L-658H |
| Product Overview : | Recombinant Human FSD1L protein(NP_001138785.1)(418-530 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 418-530 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FSD1L fibronectin type III and SPRY domain containing 1-like [ Homo sapiens ] |
| Official Symbol | FSD1L |
| Synonyms | fibronectin type III and SPRY domain containing 1-like; 13753; Ensembl:ENSG00000106701; MGC45564; FSD1-like protein;FSD1 C-terminal like;FSD1 N-terminal like;FSD1 N-terminal-like protein;coiled-coil domain containing 10;cystatin and DUF19 domain containing 1;coiled-coil domain-containing protein 10; MIR1; CCDC10; FSD1CL; FSD1NL; CSDUFD1 |
| Gene ID | 83856 |
| mRNA Refseq | NM_001145313.1 |
| Protein Refseq | NP_001138785.1 |
| MIM | 609829 |
| UniProt ID | B7Z3W5 |
| ◆ Recombinant Proteins | ||
| FSD1L-2551H | Recombinant Human FSD1L Protein, MYC/DDK-tagged | +Inquiry |
| Fsd1l-3089M | Recombinant Mouse Fsd1l Protein, Myc/DDK-tagged | +Inquiry |
| FSD1L-4516H | Recombinant Human FSD1L Protein, GST-tagged | +Inquiry |
| FSD1L-5086HF | Recombinant Full Length Human FSD1L Protein, GST-tagged | +Inquiry |
| FSD1L-4579H | Recombinant Human FSD1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FSD1L-673HCL | Recombinant Human FSD1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSD1L Products
Required fields are marked with *
My Review for All FSD1L Products
Required fields are marked with *




