Recombinant Human FSD1L protein, His-tagged
Cat.No. : | FSD1L-658H |
Product Overview : | Recombinant Human FSD1L protein(NP_001138785.1)(418-530 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 418-530 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FSD1L fibronectin type III and SPRY domain containing 1-like [ Homo sapiens ] |
Official Symbol | FSD1L |
Synonyms | fibronectin type III and SPRY domain containing 1-like; 13753; Ensembl:ENSG00000106701; MGC45564; FSD1-like protein;FSD1 C-terminal like;FSD1 N-terminal like;FSD1 N-terminal-like protein;coiled-coil domain containing 10;cystatin and DUF19 domain containing 1;coiled-coil domain-containing protein 10; MIR1; CCDC10; FSD1CL; FSD1NL; CSDUFD1 |
Gene ID | 83856 |
mRNA Refseq | NM_001145313.1 |
Protein Refseq | NP_001138785.1 |
MIM | 609829 |
UniProt ID | B7Z3W5 |
◆ Recombinant Proteins | ||
FSD1L-2551H | Recombinant Human FSD1L Protein, MYC/DDK-tagged | +Inquiry |
FSD1L-5086HF | Recombinant Full Length Human FSD1L Protein, GST-tagged | +Inquiry |
FSD1L-3374M | Recombinant Mouse FSD1L Protein, His (Fc)-Avi-tagged | +Inquiry |
FSD1L-13014H | Recombinant Human FSD1L, GST-tagged | +Inquiry |
FSD1L-4516H | Recombinant Human FSD1L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSD1L-673HCL | Recombinant Human FSD1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSD1L Products
Required fields are marked with *
My Review for All FSD1L Products
Required fields are marked with *