Recombinant Human FSD1L protein, His-tagged

Cat.No. : FSD1L-658H
Product Overview : Recombinant Human FSD1L protein(NP_001138785.1)(418-530 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 418-530 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FSD1L fibronectin type III and SPRY domain containing 1-like [ Homo sapiens ]
Official Symbol FSD1L
Synonyms fibronectin type III and SPRY domain containing 1-like; 13753; Ensembl:ENSG00000106701; MGC45564; FSD1-like protein;FSD1 C-terminal like;FSD1 N-terminal like;FSD1 N-terminal-like protein;coiled-coil domain containing 10;cystatin and DUF19 domain containing 1;coiled-coil domain-containing protein 10; MIR1; CCDC10; FSD1CL; FSD1NL; CSDUFD1
Gene ID 83856
mRNA Refseq NM_001145313.1
Protein Refseq NP_001138785.1
MIM 609829
UniProt ID B7Z3W5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSD1L Products

Required fields are marked with *

My Review for All FSD1L Products

Required fields are marked with *

0
cart-icon
0
compare icon