Recombinant Human FSHB Protein, GST-tagged

• Cat.No.: FSHB-4519H
• Product Overview: Human FSHB partial ORF ( NP_000501.1, 19 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
• Molecular Mass: 37.95 kDa
• AA Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FSHB follicle stimulating hormone, beta polypeptide [ Homo sapiens ]
• Official Symbol: FSHB
• Synonyms: FSHB; follicle stimulating hormone, beta polypeptide; follitropin subunit beta; follicle stimulating hormone beta subunit; follitropin; beta chain; FSH-B; FSH-beta; follitropin beta chain; follitropin, beta chain; follicle-stimulating hormone beta subunit
• Gene ID: 2488
• mRNA Refseq: NM_000510
• Protein Refseq: NP_000501
• MIM: 136530
• UniProt ID: P01225