Recombinant Human FSHB Protein, GST-tagged

Cat.No. : FSHB-4519H
Product Overview : Human FSHB partial ORF ( NP_000501.1, 19 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
Availability January 27, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq
Molecular Mass : 37.95 kDa
AA Sequence : NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FSHB follicle stimulating hormone, beta polypeptide [ Homo sapiens ]
Official Symbol FSHB
Synonyms FSHB; follicle stimulating hormone, beta polypeptide; follitropin subunit beta; follicle stimulating hormone beta subunit; follitropin; beta chain; FSH-B; FSH-beta; follitropin beta chain; follitropin, beta chain; follicle-stimulating hormone beta subunit;
Gene ID 2488
mRNA Refseq NM_000510
Protein Refseq NP_000501
MIM 136530
UniProt ID P01225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSHB Products

Required fields are marked with *

My Review for All FSHB Products

Required fields are marked with *

0
cart-icon
0
compare icon