Recombinant Human FSHB Protein, GST-tagged
| Cat.No. : | FSHB-4519H |
| Product Overview : | Human FSHB partial ORF ( NP_000501.1, 19 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | September 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq |
| Molecular Mass : | 37.95 kDa |
| AA Sequence : | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FSHB follicle stimulating hormone, beta polypeptide [ Homo sapiens ] |
| Official Symbol | FSHB |
| Synonyms | FSHB; follicle stimulating hormone, beta polypeptide; follitropin subunit beta; follicle stimulating hormone beta subunit; follitropin; beta chain; FSH-B; FSH-beta; follitropin beta chain; follitropin, beta chain; follicle-stimulating hormone beta subunit; |
| Gene ID | 2488 |
| mRNA Refseq | NM_000510 |
| Protein Refseq | NP_000501 |
| MIM | 136530 |
| UniProt ID | P01225 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSHB Products
Required fields are marked with *
My Review for All FSHB Products
Required fields are marked with *
