Recombinant Human FSHR protein(18-366aa), His-Trx-tagged

Cat.No. : FSHR-1316H
Product Overview : Recombinant Human FSHR protein(P23945)(18-366aa), fused with N-terminal His and Trx tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Trx
Protein Length : 18-366aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 58.1 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Gene Name FSHR follicle stimulating hormone receptor [ Homo sapiens ]
Official Symbol FSHR
Synonyms FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668;
Gene ID 2492
mRNA Refseq NM_000145
Protein Refseq NP_000136
MIM 136435
UniProt ID P23945

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSHR Products

Required fields are marked with *

My Review for All FSHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon