Recombinant Human FSHR protein(18-366aa), His-Trx-tagged
Cat.No. : | FSHR-1316H |
Product Overview : | Recombinant Human FSHR protein(P23945)(18-366aa), fused with N-terminal His and Trx tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Protein Length : | 18-366aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR |
Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | FSHR |
Synonyms | FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
Gene ID | 2492 |
mRNA Refseq | NM_000145 |
Protein Refseq | NP_000136 |
MIM | 136435 |
UniProt ID | P23945 |
◆ Recombinant Proteins | ||
FSHR-2396R | Recombinant Rat FSHR Protein | +Inquiry |
FSHR-2930H | Recombinant Human FSHR protein, His-tagged | +Inquiry |
FSHR-13016H | Recombinant Human FSHR, His-tagged | +Inquiry |
FSHR-227Z | Recombinant Zebrafish FSHR | +Inquiry |
FSHR-0293H | Active Recombinant Human FSHR Full Length Transmembrane protein(Nanodisc) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *
0
Inquiry Basket