Recombinant Human FSHR protein(18-366aa), His-Trx-tagged

• Cat.No.: FSHR-1316H
• Product Overview: Recombinant Human FSHR protein(P23945)(18-366aa), fused with N-terminal His and Trx tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Trx
• Protein Length: 18-366aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Gene Information

• Gene Name: FSHR follicle stimulating hormone receptor [ Homo sapiens ]
• Official Symbol: FSHR
• Synonyms: FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668
• Gene ID: 2492
• mRNA Refseq: NM_000145
• Protein Refseq: NP_000136
• MIM: 136435
• UniProt ID: P23945