Recombinant Human FSHR Protein, His-tagged

Cat.No. : FSHR-24H
Product Overview : Recombinant Human FSHR Protein (18-366 aa) is produced by Mammalian cell expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 18-366 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 43.5 kDa
AA Sequence : CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name FSHR follicle stimulating hormone receptor [ Homo sapiens ]
Official Symbol FSHR
Synonyms FSHR; ODG1; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668;
Gene ID 2492
mRNA Refseq NM_000145
Protein Refseq NP_000136
MIM 136435
UniProt ID P23945

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FSHR Products

Required fields are marked with *

My Review for All FSHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon