Recombinant Human FSHR Protein, His-tagged

• Cat.No.: FSHR-24H
• Product Overview: Recombinant Human FSHR Protein (18-366 aa) is produced by Mammalian cell expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 18-366 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 43.5 kDa
• AA Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: FSHR follicle stimulating hormone receptor [ Homo sapiens ]
• Official Symbol: FSHR
• Synonyms: FSHR; ODG1; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668
• Gene ID: 2492
• mRNA Refseq: NM_000145
• Protein Refseq: NP_000136
• MIM: 136435
• UniProt ID: P23945