Recombinant Human FSHR Protein, His-tagged
| Cat.No. : | FSHR-24H |
| Product Overview : | Recombinant Human FSHR Protein (18-366 aa) is produced by Mammalian cell expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 18-366 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 43.5 kDa |
| AA Sequence : | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
| Official Symbol | FSHR |
| Synonyms | FSHR; ODG1; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
| Gene ID | 2492 |
| mRNA Refseq | NM_000145 |
| Protein Refseq | NP_000136 |
| MIM | 136435 |
| UniProt ID | P23945 |
| ◆ Recombinant Proteins | ||
| FSHR-13016H | Recombinant Human FSHR protein, His-tagged | +Inquiry |
| FSHR-2930H | Recombinant Human FSHR protein, His-tagged | +Inquiry |
| RFL12396OF | Recombinant Full Length Sheep Follicle-Stimulating Hormone Receptor(Fshr) Protein, His-Tagged | +Inquiry |
| FSHR-4732C | Recombinant Chicken FSHR protein | +Inquiry |
| RFL10368MF | Recombinant Full Length Mouse Follicle-Stimulating Hormone Receptor(Fshr) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *
