Recombinant Human FSHR Protein, His tagged, R-PE labeled
Cat.No. : | FSHR-24H-RPE |
Product Overview : | R-PE labeled Recombinant Human FSHR Protein with His tag was expressed in HEK293. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | The protein has a calculated MW of 40 kDa. |
AA Sequence : | HHHHHHCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.83 mg/mL |
Storage Buffer : | Sterile PBS, pH 7.4, 0.5% SKL |
Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | FSHR |
Synonyms | FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
Gene ID | 2492 |
mRNA Refseq | NM_000145 |
Protein Refseq | NP_000136 |
MIM | 136435 |
UniProt ID | P23945 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *
0
Inquiry Basket