Recombinant Human FSHR Protein, His tagged, R-PE labeled

Cat.No. : FSHR-24H-RPE
Product Overview : R-PE labeled Recombinant Human FSHR Protein with His tag was expressed in HEK293.
Availability January 11, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Mutations in this gene cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. Alternative splicing results in multiple transcript variants.
Molecular Mass : The protein has a calculated MW of 40 kDa.
AA Sequence : HHHHHHCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.83 mg/mL
Storage Buffer : Sterile PBS, pH 7.4, 0.5% SKL
Conjugation : R-PE
Gene Name FSHR follicle stimulating hormone receptor [ Homo sapiens ]
Official Symbol FSHR
Synonyms FSHR; follicle stimulating hormone receptor; ODG1; follicle-stimulating hormone receptor; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668;
Gene ID 2492
mRNA Refseq NM_000145
Protein Refseq NP_000136
MIM 136435
UniProt ID P23945

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSHR Products

Required fields are marked with *

My Review for All FSHR Products

Required fields are marked with *

0
cart-icon
0
compare icon