Recombinant Human FST Protein, His tagged

Cat.No. : FST-001H
Product Overview : Recombinant Human FST Protein with His tag was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 30-329 aa
Description : Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
AASequence : MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDHHHHHHHH
Molecular Mass : 34 kDa
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration : 0.9 mg/mL by BCA
Gene Name FST follistatin [ Homo sapiens (human) ]
Official Symbol FST
Synonyms FST; follistatin; FS; activin-binding protein; follistatin isoform FST317
Gene ID 10468
mRNA Refseq NM_006350
Protein Refseq NP_006341
MIM 136470
UniProt ID P19883

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FST Products

Required fields are marked with *

My Review for All FST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon