Recombinant Human FST Protein, His tagged
Cat.No. : | FST-001H |
Product Overview : | Recombinant Human FST Protein with His tag was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 30-329 aa |
Description : | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. |
AASequence : | MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDHHHHHHHH |
Molecular Mass : | 34 kDa |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Concentration : | 0.9 mg/mL by BCA |
Gene Name | FST follistatin [ Homo sapiens (human) ] |
Official Symbol | FST |
Synonyms | FST; follistatin; FS; activin-binding protein; follistatin isoform FST317 |
Gene ID | 10468 |
mRNA Refseq | NM_006350 |
Protein Refseq | NP_006341 |
MIM | 136470 |
UniProt ID | P19883 |
◆ Recombinant Proteins | ||
FST-4524H | Recombinant Human FST Protein, GST-tagged | +Inquiry |
FST-2557H | Recombinant Human FST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FST-2398R | Recombinant Rat FST Protein | +Inquiry |
FST-029H | Recombinant Human FST Protein, His-tagged | +Inquiry |
Fst-8663M | Recombinant Mouse Fst, Fc tagged | +Inquiry |
◆ Native Proteins | ||
FST-001H | Recombinant Human FST Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FST-1771MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-001MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FST Products
Required fields are marked with *
My Review for All FST Products
Required fields are marked with *
0
Inquiry Basket