Recombinant Human FSTL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FSTL3-558H
• Product Overview: FSTL3 MS Standard C13 and N15-labeled recombinant protein (NP_005851) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis.
• Molecular Mass: 27.7 kDa
• AA Sequence: MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FSTL3 follistatin like 3 [ Homo sapiens (human) ]
• Official Symbol: FSTL3
• Synonyms: FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein
• Gene ID: 10272
• mRNA Refseq: NM_005860
• Protein Refseq: NP_005851
• MIM: 605343
• UniProt ID: O95633