Recombinant Human FSTL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FSTL3-558H
Product Overview : FSTL3 MS Standard C13 and N15-labeled recombinant protein (NP_005851) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis.
Molecular Mass : 27.7 kDa
AA Sequence : MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FSTL3 follistatin like 3 [ Homo sapiens (human) ]
Official Symbol FSTL3
Synonyms FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein;
Gene ID 10272
mRNA Refseq NM_005860
Protein Refseq NP_005851
MIM 605343
UniProt ID O95633

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSTL3 Products

Required fields are marked with *

My Review for All FSTL3 Products

Required fields are marked with *

0
cart-icon