Recombinant Human FSTL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FSTL3-558H |
Product Overview : | FSTL3 MS Standard C13 and N15-labeled recombinant protein (NP_005851) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis. |
Molecular Mass : | 27.7 kDa |
AA Sequence : | MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FSTL3 follistatin like 3 [ Homo sapiens (human) ] |
Official Symbol | FSTL3 |
Synonyms | FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein; |
Gene ID | 10272 |
mRNA Refseq | NM_005860 |
Protein Refseq | NP_005851 |
MIM | 605343 |
UniProt ID | O95633 |
◆ Recombinant Proteins | ||
FSTL3-753HFL | Recombinant Full Length Human FSTL3 Protein, C-Flag-tagged | +Inquiry |
FSTL3-4527H | Recombinant Human FSTL3 Protein, GST-tagged | +Inquiry |
FSTL3-2056R | Recombinant Rat FSTL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FSTL3-1089H | Recombinant Human FSTL3 protein, His-tagged | +Inquiry |
Fstl3-3094M | Recombinant Mouse Fstl3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
FSTL3-940H | Recombinant Human FSTL3 Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL3 Products
Required fields are marked with *
My Review for All FSTL3 Products
Required fields are marked with *