Recombinant Human FSTL4 Protein, GST-tagged
| Cat.No. : | FSTL4-4528H | 
| Product Overview : | Human FSTL4 full-length ORF ( AAH24300.1, 1 a.a. - 605 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | FSTL4 (Follistatin Like 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is FSTL5. | 
| Molecular Mass : | 93.6 kDa | 
| AA Sequence : | MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYIAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPPINLEQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | FSTL4 follistatin-like 4 [ Homo sapiens ] | 
| Official Symbol | FSTL4 | 
| Synonyms | FSTL4; follistatin-like 4; follistatin-related protein 4; KIAA1061; follistatin-like protein 4; | 
| Gene ID | 23105 | 
| mRNA Refseq | NM_015082 | 
| Protein Refseq | NP_055897 | 
| UniProt ID | Q6MZW2 | 
| ◆ Recombinant Proteins | ||
| FSTL4-6066M | Recombinant Mouse FSTL4 Protein | +Inquiry | 
| Fstl4-3095M | Recombinant Mouse Fstl4 Protein, Myc/DDK-tagged | +Inquiry | 
| FSTL4-688H | Active Recombinant Human FSTL4 Protein, His-tagged | +Inquiry | 
| FSTL4-5117HF | Recombinant Full Length Human FSTL4 Protein, GST-tagged | +Inquiry | 
| FSTL4-13021H | Recombinant Human FSTL4, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FSTL4-674HCL | Recombinant Human FSTL4 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL4 Products
Required fields are marked with *
My Review for All FSTL4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            