Recombinant Human FUCA1
| Cat.No. : | FUCA1-28956TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag. P04066, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. Mutations in this gene are associated with fucosidosis (FUCA1D), which is an autosomal recessive lysosomal storage disease. A pseudogene of this locus is present on chr 2. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
| Sequence Similarities : | Belongs to the glycosyl hydrolase 29 family. |
| Gene Name | FUCA1 fucosidase, alpha-L- 1, tissue [ Homo sapiens ] |
| Official Symbol | FUCA1 |
| Synonyms | FUCA1; fucosidase, alpha-L- 1, tissue; tissue alpha-L-fucosidase; |
| Gene ID | 2517 |
| mRNA Refseq | NM_000147 |
| Protein Refseq | NP_000138 |
| MIM | 612280 |
| Uniprot ID | P04066 |
| Chromosome Location | 1p34 |
| Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; |
| Function | alpha-L-fucosidase activity; cation binding; hydrolase activity, acting on glycosyl bonds; sugar binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUCA1 Products
Required fields are marked with *
My Review for All FUCA1 Products
Required fields are marked with *
