Recombinant Human FUCA1
Cat.No. : | FUCA1-28956TH |
Product Overview : | Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag. P04066, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. Mutations in this gene are associated with fucosidosis (FUCA1D), which is an autosomal recessive lysosomal storage disease. A pseudogene of this locus is present on chr 2. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
Sequence Similarities : | Belongs to the glycosyl hydrolase 29 family. |
Gene Name | FUCA1 fucosidase, alpha-L- 1, tissue [ Homo sapiens ] |
Official Symbol | FUCA1 |
Synonyms | FUCA1; fucosidase, alpha-L- 1, tissue; tissue alpha-L-fucosidase; |
Gene ID | 2517 |
mRNA Refseq | NM_000147 |
Protein Refseq | NP_000138 |
MIM | 612280 |
Uniprot ID | P04066 |
Chromosome Location | 1p34 |
Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; |
Function | alpha-L-fucosidase activity; cation binding; hydrolase activity, acting on glycosyl bonds; sugar binding; |
◆ Recombinant Proteins | ||
FUCA1-6081M | Recombinant Mouse FUCA1 Protein | +Inquiry |
FUCA1-2063R | Recombinant Rat FUCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUCA1-1835H | Recombinant Human FUCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FUCA1-2983H | Recombinant Human FUCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUCA1-8618H | Recombinant Human FUCA1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUCA1-1212HCL | Recombinant Human FUCA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUCA1 Products
Required fields are marked with *
My Review for All FUCA1 Products
Required fields are marked with *