Recombinant Human Full length PTMA protein(1-111 aa), N-MBP & C-His-tagged

• Cat.No.: PTMA-2879H
• Product Overview: Recombinant Human Full length PTMA protein(P06454)(1-111 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 1-111 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Gene Information

• Gene Name: PTMA prothymosin, alpha [ Homo sapiens ]
• Official Symbol: PTMA
• Synonyms: PTMA; prothymosin, alpha; prothymosin, alpha (gene sequence 28) , TMSA; prothymosin alpha; gene sequence 28; prothymosin alpha protein; TMSA; MGC104802
• Gene ID: 5757
• mRNA Refseq: NM_001099285
• Protein Refseq: NP_001092755
• MIM: 188390
• UniProt ID: P06454