Recombinant Human FUNDC1 Protein, GST-tagged

Cat.No. : FUNDC1-4549H
Product Overview : Human FUNDC1 full-length ORF ( NP_776155.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known. [provided by RefSeq, Sep 2011]
Molecular Mass : 43.6 kDa
AA Sequence : MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUNDC1 FUN14 domain containing 1 [ Homo sapiens ]
Official Symbol FUNDC1
Synonyms FUNDC1; FUN14 domain containing 1; FUN14 domain-containing protein 1; MGC51029;
Gene ID 139341
mRNA Refseq NM_173794
Protein Refseq NP_776155
MIM 300871
UniProt ID Q8IVP5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUNDC1 Products

Required fields are marked with *

My Review for All FUNDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon