Recombinant Human FUNDC1 Protein, GST-tagged
| Cat.No. : | FUNDC1-4549H |
| Product Overview : | Human FUNDC1 full-length ORF ( NP_776155.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known. [provided by RefSeq, Sep 2011] |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FUNDC1 FUN14 domain containing 1 [ Homo sapiens ] |
| Official Symbol | FUNDC1 |
| Synonyms | FUNDC1; FUN14 domain containing 1; FUN14 domain-containing protein 1; MGC51029; |
| Gene ID | 139341 |
| mRNA Refseq | NM_173794 |
| Protein Refseq | NP_776155 |
| MIM | 300871 |
| UniProt ID | Q8IVP5 |
| ◆ Recombinant Proteins | ||
| FUNDC1-2662H | Recombinant Human FUNDC1 Protein, His-tagged | +Inquiry |
| RFL34988RF | Recombinant Full Length Rat Fun14 Domain-Containing Protein 1(Fundc1) Protein, His-Tagged | +Inquiry |
| FUNDC1-2985H | Recombinant Human FUNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FUNDC1-1765R | Recombinant Rhesus monkey FUNDC1 Protein, His-tagged | +Inquiry |
| FUNDC1-3387M | Recombinant Mouse FUNDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUNDC1-6121HCL | Recombinant Human FUNDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUNDC1 Products
Required fields are marked with *
My Review for All FUNDC1 Products
Required fields are marked with *



