Recombinant Human FUNDC2 Protein, GST-tagged
Cat.No. : | FUNDC2-4550H |
Product Overview : | Human FUNDC2 full-length ORF (NP_076423.2, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FUNDC2 (FUN14 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is FUNDC1. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUNDC2 FUN14 domain containing 2 [ Homo sapiens ] |
Official Symbol | FUNDC2 |
Synonyms | FUNDC2; FUN14 domain containing 2; FUN14 domain-containing protein 2; DC44; HCBP6; HCC-3; cervical cancer oncogene 3; cervical cancer proto-oncogene 3 protein; hepatitis C virus core-binding protein 6; HCC3; PD03104; MGC2495; FLJ33773; MGC131676; |
Gene ID | 65991 |
mRNA Refseq | NM_023934 |
Protein Refseq | NP_076423 |
UniProt ID | Q9BWH2 |
◆ Recombinant Proteins | ||
FUNDC2-13035H | Recombinant Human FUNDC2 protein, GST-tagged | +Inquiry |
FUNDC2-5138HF | Recombinant Full Length Human FUNDC2 Protein, GST-tagged | +Inquiry |
FUNDC2-3388M | Recombinant Mouse FUNDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUNDC2-6085M | Recombinant Mouse FUNDC2 Protein | +Inquiry |
FUNDC2-4550H | Recombinant Human FUNDC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUNDC2-6120HCL | Recombinant Human FUNDC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUNDC2 Products
Required fields are marked with *
My Review for All FUNDC2 Products
Required fields are marked with *