Recombinant Human FUNDC2 Protein, GST-tagged

Cat.No. : FUNDC2-4550H
Product Overview : Human FUNDC2 full-length ORF (NP_076423.2, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FUNDC2 (FUN14 Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is FUNDC1.
Molecular Mass : 47.1 kDa
AA Sequence : METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUNDC2 FUN14 domain containing 2 [ Homo sapiens ]
Official Symbol FUNDC2
Synonyms FUNDC2; FUN14 domain containing 2; FUN14 domain-containing protein 2; DC44; HCBP6; HCC-3; cervical cancer oncogene 3; cervical cancer proto-oncogene 3 protein; hepatitis C virus core-binding protein 6; HCC3; PD03104; MGC2495; FLJ33773; MGC131676;
Gene ID 65991
mRNA Refseq NM_023934
Protein Refseq NP_076423
UniProt ID Q9BWH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUNDC2 Products

Required fields are marked with *

My Review for All FUNDC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon