Recombinant Human FUOM Protein, GST-tagged

• Cat.No.: FUOM-418H
• Product Overview: Human C10orf125 full-length ORF (BAC85178.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41 kDa
• AA Sequence: MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMEPVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGC
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUOM fucose mutarotase [ Homo sapiens ]
• Official Symbol: FUOM
• Synonyms: FUCU; FucM; C10orf125
• Gene ID: 282969
• mRNA Refseq: NM_198472.2
• Protein Refseq: NP_940874.2
• UniProt ID: A2VDF0