Recombinant Human FUOM Protein, GST-tagged
Cat.No. : | FUOM-418H |
Product Overview : | Human C10orf125 full-length ORF (BAC85178.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41 kDa |
AA Sequence : | MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMEPVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGC |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUOM fucose mutarotase [ Homo sapiens ] |
Official Symbol | FUOM |
Synonyms | FUCU; FucM; C10orf125 |
Gene ID | 282969 |
mRNA Refseq | NM_198472.2 |
Protein Refseq | NP_940874.2 |
UniProt ID | A2VDF0 |
◆ Recombinant Proteins | ||
FUOM-418H | Recombinant Human FUOM Protein, GST-tagged | +Inquiry |
FUOM-1256Z | Recombinant Zebrafish FUOM | +Inquiry |
FUOM-3389M | Recombinant Mouse FUOM Protein, His (Fc)-Avi-tagged | +Inquiry |
FUOM-1637HF | Recombinant Full Length Human FUOM Protein, GST-tagged | +Inquiry |
FUOM-2155H | Recombinant Human FUOM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUOM-8372HCL | Recombinant Human C10orf125 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUOM Products
Required fields are marked with *
My Review for All FUOM Products
Required fields are marked with *
0
Inquiry Basket