Recombinant Human FUS, His-tagged

Cat.No. : FUS-30143TH
Product Overview : Recombinant fragment, corresponding to amino acids 262-526 of Human TLS/FUS with an N-terminal His tag; Predicted MWt 29 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 262-526 a.a.
Description : This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 106 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATV SFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR GGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGG GGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGG FRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Sequence Similarities : Belongs to the RRM TET family.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.
Gene Name FUS fused in sarcoma [ Homo sapiens ]
Official Symbol FUS
Synonyms FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRN
Gene ID 2521
mRNA Refseq NM_001170634
Protein Refseq NP_001164105
MIM 137070
Uniprot ID P35637
Chromosome Location 16p11.2
Pathway Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function DNA binding; RNA binding; metal ion binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUS Products

Required fields are marked with *

My Review for All FUS Products

Required fields are marked with *

0
cart-icon