Recombinant Human FUS, His-tagged
| Cat.No. : | FUS-30143TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 262-526 of Human TLS/FUS with an N-terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 262-526 a.a. |
| Description : | This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitous. |
| Form : | Lyophilised:Reconstitute with 106 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATV SFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR GGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGG GGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGG FRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY |
| Sequence Similarities : | Belongs to the RRM TET family.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain. |
| Gene Name | FUS fused in sarcoma [ Homo sapiens ] |
| Official Symbol | FUS |
| Synonyms | FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRN |
| Gene ID | 2521 |
| mRNA Refseq | NM_001170634 |
| Protein Refseq | NP_001164105 |
| MIM | 137070 |
| Uniprot ID | P35637 |
| Chromosome Location | 16p11.2 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
| Function | DNA binding; RNA binding; metal ion binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| Fus-462M | Recombinant Mouse Fus Protein, His-tagged | +Inquiry |
| FUS-947H | Recombinant Human FUS Protein, His (Fc)-Avi-tagged | +Inquiry |
| FUS-1121C | Recombinant Chicken FUS | +Inquiry |
| FUS-5669H | Recombinant Human FUS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FUS-10HFL | Active Recombinant Full Length Human FUS Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUS-6118HCL | Recombinant Human FUS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUS Products
Required fields are marked with *
My Review for All FUS Products
Required fields are marked with *
