Recombinant Human FUS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FUS-5669H |
Product Overview : | FUS MS Standard C13 and N15-labeled recombinant protein (NP_004951) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FUS fused in sarcoma [ Homo sapiens (human) ] |
Official Symbol | FUS |
Synonyms | FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6, fusion (involved in t(12;16) in malignant liposarcoma), fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; TLS; translocated in liposarcoma; oncogene FUS; oncogene TLS; fus-like protein; 75 kDa DNA-pairing protein; fusion gene in myxoid liposarcoma; translocated in liposarcoma protein; ALS6; POMP75; HNRNPP2; |
Gene ID | 2521 |
mRNA Refseq | NM_004960 |
Protein Refseq | NP_004951 |
MIM | 137070 |
UniProt ID | P35637 |
◆ Recombinant Proteins | ||
FUS-6088M | Recombinant Mouse FUS Protein | +Inquiry |
Fus-462M | Recombinant Mouse Fus Protein, His-tagged | +Inquiry |
FUS-4555H | Recombinant Human FUS Protein, GST-tagged | +Inquiry |
FUS-10HFL | Active Recombinant Full Length Human FUS Protein, C-Flag-tagged | +Inquiry |
FUS-13037H | Recombinant Human FUS, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUS-6118HCL | Recombinant Human FUS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUS Products
Required fields are marked with *
My Review for All FUS Products
Required fields are marked with *
0
Inquiry Basket