Recombinant Human FUT1 Protein, His-tagged
Cat.No. : | FUT1-4558H |
Product Overview : | Recombinant human FUT1 Protein (72-365aa) with a 6*His tag was expressed in E.coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 72-365 a.a. |
Description : | This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. |
Form : | Powder |
AA Sequence : | QHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Storage Buffer : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | FUT1 fucosyltransferase 1 (H blood group) [ Homo sapiens (human) ] |
Official Symbol | FUT1 |
Synonyms | FUT1; fucosyltransferase 1 (H blood group); H; HH; HSC; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H glycosyltransferase; H glycosytransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; blood group H alpha 2-fucosyltransferase; galactoside 2-alpha-L-fucosyltransferase; nonfunctional fucosyltransferase 1; truncated FUT1; truncated alpha(1,2)fucosyltransferase; truncated fucosyltransferase 1; EC 2.4.1.344 |
Gene ID | 2523 |
mRNA Refseq | NM_000148 |
Protein Refseq | NP_000139 |
MIM | 211100 |
UniProt ID | P19526 |
◆ Recombinant Proteins | ||
RFL8415HF | Recombinant Full Length Human Galactoside 2-Alpha-L-Fucosyltransferase 1(Fut1) Protein, His-Tagged | +Inquiry |
FUT1-1768R | Recombinant Rhesus monkey FUT1 Protein, His-tagged | +Inquiry |
Fut1-1534M | Recombinant Mouse Fut1 Protein, His-tagged | +Inquiry |
Fut1-1535R | Recombinant Rat Fut1 Protein, His-tagged | +Inquiry |
FUT1-2411R | Recombinant Rat FUT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUT1 Products
Required fields are marked with *
My Review for All FUT1 Products
Required fields are marked with *
0
Inquiry Basket