Recombinant Human FUT1 Protein, His-tagged

Cat.No. : FUT1-4558H
Product Overview : Recombinant human FUT1 Protein (72-365aa) with a 6*His tag was expressed in E.coli.
Availability January 10, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 72-365 a.a.
Description : This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Form : Powder
AA Sequence : QHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage : Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Storage Buffer : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name FUT1 fucosyltransferase 1 (H blood group) [ Homo sapiens (human) ]
Official Symbol FUT1
Synonyms FUT1; fucosyltransferase 1 (H blood group); H; HH; HSC; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H glycosyltransferase; H glycosytransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; blood group H alpha 2-fucosyltransferase; galactoside 2-alpha-L-fucosyltransferase; nonfunctional fucosyltransferase 1; truncated FUT1; truncated alpha(1,2)fucosyltransferase; truncated fucosyltransferase 1; EC 2.4.1.344
Gene ID 2523
mRNA Refseq NM_000148
Protein Refseq NP_000139
MIM 211100
UniProt ID P19526

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT1 Products

Required fields are marked with *

My Review for All FUT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon