Recombinant Human FUT2 Protein (AA 34-343), N-6×His/GFP tagged

Cat.No. : FUT2-26H
Product Overview : Recombinant Human FUT2 Protein (AA 34-343) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 34-343
Description : This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. The encoded protein is important for the final step in the soluble ABO blood group antigen synthesis pathway. It is also involved in cell-cell interaction, cell surface expression, and cell proliferation. Mutations in this gene are a cause of the H-Bombay blood group where red blood cells lack the H antigen.
Molecular Mass : 65-70 kDa
AA Sequence : KIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
Purity : >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name FUT2 fucosyltransferase 2 (secretor status included) [ Homo sapiens (human) ]
Official Symbol FUT2
Synonyms FUT2; fucosyltransferase 2 (secretor status included); SE; galactoside 2-alpha-L-fucosyltransferase 2; alpha (1; 2) fucosyltransferase; alpha(1; 2)FT2; galactoside 2 alpha L fucosyltransferase 2; GDP L fucose:beta D galactoside 2 alpha L fucosyltransferase 2; Se2; SEC2; secretor blood group alpha 2 fucosyltransferase; secretor factor; sej; alpha(1,2)FT2; alpha(1,2)FT 2; alpha (1,2) fucosyltransferase; secretor blood group alpha-2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; B12QTL1;
Gene ID 2524
mRNA Refseq NM_000511
Protein Refseq NP_000502
MIM 182100
UniProt ID Q10981

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT2 Products

Required fields are marked with *

My Review for All FUT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon