Recombinant Human FUT2 Protein (AA 34-343), N-6×His/GFP tagged
| Cat.No. : | FUT2-26H |
| Product Overview : | Recombinant Human FUT2 Protein (AA 34-343) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 34-343 |
| Description : | This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. The encoded protein is important for the final step in the soluble ABO blood group antigen synthesis pathway. It is also involved in cell-cell interaction, cell surface expression, and cell proliferation. Mutations in this gene are a cause of the H-Bombay blood group where red blood cells lack the H antigen. |
| Molecular Mass : | 65-70 kDa |
| AA Sequence : | KIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH |
| Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | FUT2 fucosyltransferase 2 (secretor status included) [ Homo sapiens (human) ] |
| Official Symbol | FUT2 |
| Synonyms | FUT2; fucosyltransferase 2 (secretor status included); SE; galactoside 2-alpha-L-fucosyltransferase 2; alpha (1; 2) fucosyltransferase; alpha(1; 2)FT2; galactoside 2 alpha L fucosyltransferase 2; GDP L fucose:beta D galactoside 2 alpha L fucosyltransferase 2; Se2; SEC2; secretor blood group alpha 2 fucosyltransferase; secretor factor; sej; alpha(1,2)FT2; alpha(1,2)FT 2; alpha (1,2) fucosyltransferase; secretor blood group alpha-2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; B12QTL1; |
| Gene ID | 2524 |
| mRNA Refseq | NM_000511 |
| Protein Refseq | NP_000502 |
| MIM | 182100 |
| UniProt ID | Q10981 |
| ◆ Recombinant Proteins | ||
| FUT2-5177HF | Recombinant Full Length Human FUT2 Protein, GST-tagged | +Inquiry |
| RFL7555PF | Recombinant Full Length Pongo Pygmaeus Galactoside 2-Alpha-L-Fucosyltransferase 2(Fut2) Protein, His-Tagged | +Inquiry |
| FUT2-4559H | Recombinant Human FUT2 Protein, GST-tagged | +Inquiry |
| FUT2-2414R | Recombinant Rat FUT2 Protein | +Inquiry |
| FUT2-1536H | Recombinant Human FUT2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT2-6115HCL | Recombinant Human FUT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT2 Products
Required fields are marked with *
My Review for All FUT2 Products
Required fields are marked with *
