Recombinant Full Length Pan Troglodytes Galactoside 2-Alpha-L-Fucosyltransferase 2(Fut2) Protein, His-Tagged
| Cat.No. : | RFL16690PF |
| Product Overview : | Recombinant Full Length Pan troglodytes Galactoside 2-alpha-L-fucosyltransferase 2(FUT2) Protein (O77485) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pan troglodytes |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-343) |
| Form : | Lyophilized powder |
| AA Sequence : | MLVVQMPFSFPVAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSPIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWMGIAADLSPLLKH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FUT2 |
| Synonyms | FUT2; Galactoside alpha-(1,2-fucosyltransferase 2; Alpha(1,2FT 2; Fucosyltransferase 2; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; Type 1 galactoside alpha-(1,2-fucosyltransferase FUT2; Type 2 galactoside alpha-(1,2-fucosyltransferase |
| UniProt ID | O77485 |
| ◆ Recombinant Proteins | ||
| FUT2-2414R | Recombinant Rat FUT2 Protein | +Inquiry |
| FUT2-5177HF | Recombinant Full Length Human FUT2 Protein, GST-tagged | +Inquiry |
| FUT2-2434H | Recombinant Human FUT2 Protein (Gln29-His343), His tagged | +Inquiry |
| FUT2-1536H | Recombinant Human FUT2 Protein, His-tagged | +Inquiry |
| FUT2-13H | Recombinant Human FUT2 Protein, C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT2-6115HCL | Recombinant Human FUT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT2 Products
Required fields are marked with *
My Review for All FUT2 Products
Required fields are marked with *
