Recombinant Human FXR1 protein, His-tagged
Cat.No. : | FXR1-548H |
Product Overview : | Recombinant Human FXR1 protein(P51114)(281-358aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 281-358aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYL |
Gene Name | FXR1 fragile X mental retardation, autosomal homolog 1 [ Homo sapiens ] |
Official Symbol | FXR1 |
Synonyms | FXR1; fragile X mental retardation, autosomal homolog 1; fragile X mental retardation syndrome-related protein 1; hFXR1p; FXR1P; |
Gene ID | 8087 |
mRNA Refseq | NM_001013438 |
Protein Refseq | NP_001013456 |
MIM | 600819 |
UniProt ID | P51114 |
◆ Recombinant Proteins | ||
FXR1-13052H | Recombinant Human FXR1 protein, GST-tagged | +Inquiry |
FXR1-543H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
FXR1-941H | Recombinant Human FXR1 protein, GST-tagged | +Inquiry |
FXR1-13053H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
FXR1-546H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXR1-6106HCL | Recombinant Human FXR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXR1 Products
Required fields are marked with *
My Review for All FXR1 Products
Required fields are marked with *
0
Inquiry Basket