Recombinant Human FXYD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FXYD4-1042H
• Product Overview: FXYD4 MS Standard C13 and N15-labeled recombinant protein (NP_775183) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.
• Molecular Mass: 9.4 kDa
• AA Sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FXYD4 FXYD domain containing ion transport regulator 4 [ Homo sapiens (human) ]
• Official Symbol: FXYD4
• Synonyms: FXYD4 FXYD domain containing ion transport regulator 4; CHIF; FXYD domain-containing ion transport regulator 4; channel-inducing factor
• Gene ID: 53828
• mRNA Refseq: NM_173160
• Protein Refseq: NP_775183
• MIM: 616926
• UniProt ID: P59646