Recombinant Human FXYD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FXYD4-1042H
Product Overview : FXYD4 MS Standard C13 and N15-labeled recombinant protein (NP_775183) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.
Molecular Mass : 9.4 kDa
AA Sequence : MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FXYD4 FXYD domain containing ion transport regulator 4 [ Homo sapiens (human) ]
Official Symbol FXYD4
Synonyms FXYD4 FXYD domain containing ion transport regulator 4; CHIF; FXYD domain-containing ion transport regulator 4; channel-inducing factor
Gene ID 53828
mRNA Refseq NM_173160
Protein Refseq NP_775183
MIM 616926
UniProt ID P59646

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD4 Products

Required fields are marked with *

My Review for All FXYD4 Products

Required fields are marked with *

0
cart-icon