Recombinant Human FXYD6 Protein, GST-tagged
Cat.No. : | FXYD6-4581H |
Product Overview : | Human FXYD6 full-length ORF ( AAH18652, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and has not been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same protein isoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu. |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FXYD6 FXYD domain containing ion transport regulator 6 [ Homo sapiens (human) ] |
Official Symbol | FXYD6 |
Synonyms | FXYD6; FXYD domain containing ion transport regulator 6; FXYD domain-containing ion transport regulator 6; phosphohippolin; FXYD Domain Containing Ion Transport Regulator 6; Phosphohippolin; FXYD Domain-Containing Ion Transport Regulator 6 |
Gene ID | 53826 |
mRNA Refseq | NM_001164831 |
Protein Refseq | NP_001158303 |
MIM | 606683 |
UniProt ID | Q9H0Q3 |
◆ Recombinant Proteins | ||
FXYD6-3636C | Recombinant Chicken FXYD6 | +Inquiry |
FXYD6-5280HF | Recombinant Full Length Human FXYD6 Protein, GST-tagged | +Inquiry |
FXYD6-10221Z | Recombinant Zebrafish FXYD6 | +Inquiry |
FXYD6-4581H | Recombinant Human FXYD6 Protein, GST-tagged | +Inquiry |
FXYD6-276C | Recombinant Cynomolgus Monkey FXYD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD6-6097HCL | Recombinant Human FXYD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD6 Products
Required fields are marked with *
My Review for All FXYD6 Products
Required fields are marked with *
0
Inquiry Basket