Recombinant Human FYTTD1 Protein, GST-tagged

• Cat.No.: FYTTD1-4588H
• Product Overview: Human FYTTD1 full-length ORF ( NP_115664.2, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FYTTD1 (Forty-Two-Three Domain Containing 1) is a Protein Coding gene. Among its related pathways are Gene Expression and Transport of Mature Transcript to Cytoplasm. GO annotations related to this gene include poly(A) RNA binding and mRNA binding.
• Molecular Mass: 62.2 kDa
• AA Sequence: MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FYTTD1 forty-two-three domain containing 1 [ Homo sapiens ]
• Official Symbol: FYTTD1
• Synonyms: FYTTD1; forty-two-three domain containing 1; UAP56-interacting factor; DKFZp761B1514; UAP56 interacting factor; UIF; protein 40-2-3; forty-two-three domain-containing protein 1
• Gene ID: 84248
• mRNA Refseq: NM_001011537
• Protein Refseq: NP_001011537
• MIM: 616933
• UniProt ID: Q96QD9