Recombinant Human G0S2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: G0S2-4617H
• Product Overview: G0S2 MS Standard C13 and N15-labeled recombinant protein (NP_056529) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: G0S2 (G0/G1 Switch 2) is a Protein Coding gene. Among its related pathways are Diurnally Regulated Genes with Circadian Orthologs and Metabolism.
• Molecular Mass: 11.3 kDa
• AA Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: G0S2 G0/G1 switch 2 [ Homo sapiens (human) ]
• Official Symbol: G0S2
• Synonyms: G0S2; G0/G1 switch 2; G0/G1 switch protein 2; G0/G1 switch regulatory protein 2; G0/G1switch 2
• Gene ID: 50486
• mRNA Refseq: NM_015714
• Protein Refseq: NP_056529
• MIM: 614447
• UniProt ID: P27469