Recombinant Human G0S2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | G0S2-4617H |
Product Overview : | G0S2 MS Standard C13 and N15-labeled recombinant protein (NP_056529) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | G0S2 (G0/G1 Switch 2) is a Protein Coding gene. Among its related pathways are Diurnally Regulated Genes with Circadian Orthologs and Metabolism. |
Molecular Mass : | 11.3 kDa |
AA Sequence : | METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | G0S2 G0/G1 switch 2 [ Homo sapiens (human) ] |
Official Symbol | G0S2 |
Synonyms | G0S2; G0/G1 switch 2; G0/G1 switch protein 2; G0/G1 switch regulatory protein 2; G0/G1switch 2 |
Gene ID | 50486 |
mRNA Refseq | NM_015714 |
Protein Refseq | NP_056529 |
MIM | 614447 |
UniProt ID | P27469 |
◆ Recombinant Proteins | ||
G0S2-5096HF | Recombinant Full Length Human G0S2 Protein, GST-tagged | +Inquiry |
G0S2-1600R | Recombinant Rhesus Macaque G0S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
G0S2-2433R | Recombinant Rat G0S2 Protein | +Inquiry |
G0S2-4617H | Recombinant Human G0S2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
G0S2-438HFL | Active Recombinant Full Length Human G0S2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
G0S2-6086HCL | Recombinant Human G0S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G0S2 Products
Required fields are marked with *
My Review for All G0S2 Products
Required fields are marked with *