Recombinant Human G0S2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : G0S2-4617H
Product Overview : G0S2 MS Standard C13 and N15-labeled recombinant protein (NP_056529) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : G0S2 (G0/G1 Switch 2) is a Protein Coding gene. Among its related pathways are Diurnally Regulated Genes with Circadian Orthologs and Metabolism.
Molecular Mass : 11.3 kDa
AA Sequence : METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name G0S2 G0/G1 switch 2 [ Homo sapiens (human) ]
Official Symbol G0S2
Synonyms G0S2; G0/G1 switch 2; G0/G1 switch protein 2; G0/G1 switch regulatory protein 2; G0/G1switch 2
Gene ID 50486
mRNA Refseq NM_015714
Protein Refseq NP_056529
MIM 614447
UniProt ID P27469

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All G0S2 Products

Required fields are marked with *

My Review for All G0S2 Products

Required fields are marked with *

0
cart-icon
0
compare icon