Recombinant Human G6PC Protein, Full Length, N-His tagged
Cat.No. : | G6PC-01HFL |
Product Overview : | Recombinant Human G6PC Protein (Full Length) with N-His tag was expressed in HEK293. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Full Length |
Description : | Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys. |
Molecular Mass : | 41 kDa |
AA Sequence : | HHHHHHMEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.08 mg/mL |
Storage Buffer : | Sterile 100 mM KH2PO4, pH 7.4, 400mM KCl, 500 mM NaCl, 0.025%Triton X-100, 1mM PMSF |
Gene Name | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens (human) ] |
Official Symbol | G6PC |
Synonyms | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350 |
Gene ID | 2538 |
mRNA Refseq | NM_000151 |
Protein Refseq | NP_000142 |
MIM | 613742 |
UniProt ID | P35575 |
◆ Recombinant Proteins | ||
G6PC-1542H | Recombinant Human G6PC Protein, His-tagged | +Inquiry |
G6PC-2091R | Recombinant Rat G6PC Protein, His (Fc)-Avi-tagged | +Inquiry |
G6PC-4613H | Recombinant Human G6PC Protein, GST-tagged | +Inquiry |
G6PC-3416M | Recombinant Mouse G6PC Protein, His (Fc)-Avi-tagged | +Inquiry |
G6PC-27523TH | Recombinant Human G6PC | +Inquiry |
◆ Cell & Tissue Lysates | ||
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G6PC Products
Required fields are marked with *
My Review for All G6PC Products
Required fields are marked with *