Recombinant Human GAB1 protein, GST-tagged
| Cat.No. : | GAB1-7855H |
| Product Overview : | Recombinant Human GAB1 protein(501-724 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 501-724 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | PKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | GAB1 |
| Synonyms | GAB1; GRB2-associated binding protein 1; GRB2-associated-binding protein 1; GRB2-associated binder 1; growth factor receptor bound protein 2-associated protein 1; |
| Gene ID | 2549 |
| mRNA Refseq | NM_002039 |
| Protein Refseq | NP_002030 |
| MIM | 604439 |
| UniProt ID | Q13480 |
| ◆ Recombinant Proteins | ||
| GAB1-1450H | Recombinant Human GRB2-associated Binding Protein 1, His-tagged | +Inquiry |
| GAB1-1786H | Recombinant Human GAB1 protein, His & T7-tagged | +Inquiry |
| GAB1-12537Z | Recombinant Zebrafish GAB1 | +Inquiry |
| GAB1-7854H | Recombinant Human GAB1 protein, His-tagged | +Inquiry |
| GAB1-5128HF | Recombinant Full Length Human GAB1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAB1-6076HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
| GAB1-6075HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAB1 Products
Required fields are marked with *
My Review for All GAB1 Products
Required fields are marked with *



