Recombinant Human GAB1 protein, GST-tagged

Cat.No. : GAB1-7855H
Product Overview : Recombinant Human GAB1 protein(501-724 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 501-724 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : PKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPHGLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol GAB1
Synonyms GAB1; GRB2-associated binding protein 1; GRB2-associated-binding protein 1; GRB2-associated binder 1; growth factor receptor bound protein 2-associated protein 1;
Gene ID 2549
mRNA Refseq NM_002039
Protein Refseq NP_002030
MIM 604439
UniProt ID Q13480

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAB1 Products

Required fields are marked with *

My Review for All GAB1 Products

Required fields are marked with *

0
cart-icon